Lowscore 18 · flagged Thursday, August 27, 2026
alwaysdiscreetwalmartsweepstakes.com
The census has no day-one record for this name inside its retained window. Full domain report
Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.
Own one of these names and think the listing is wrong? Tell us and a person will look.
What matched
brand in the name
matched: walmart
very long name
matched: 32
Registrar
—
Nameserver provider
Nameservers
ns1-01.azure-dns.com, ns2-01.azure-dns.net, ns3-01.azure-dns.org, ns4-01.azure-dns.info
First-day state
unknown
HTTP status
—
Page title
—
Has a form
no
Brand echoed
walmart
Same data as JSON: /api/zone/domain/alwaysdiscreetwalmartsweepstakes.com. This page is not indexed by search engines and does not link to the site it describes.