Lowscore 16 · flagged Friday, September 25, 2026

callahanchimneysweepservices.site

Appeared in the .site zone on Friday, September 25, 2026; by the end of that day the census found active website about corporate services. Full domain report

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

What matched

lure words (login, verify, secure…)
matched: service,services
+12
very long name
matched: 28
+4
Registrar
—
Nameserver provider
Nameservers
dns1.registrar-servers.com, dns2.registrar-servers.com
First-day state
active website
HTTP status
200
Page title
Local chimney sweep & inspection for Shrewsbury homes | Callahan
Has a form
yes
Brand echoed
—

Same data as JSON: /api/zone/domain/callahanchimneysweepservices.site. This page is not indexed by search engines and does not link to the site it describes.