kitchenchimneyrepairservice.shop
Appeared in the .shop zone on Friday, October 16, 2026; by the end of that day the census found active website about food & restaurants. Full domain report
Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.
Own one of these names and think the listing is wrong? Tell us and a person will look.
What matched
Model opinions
This is a generic local kitchen-appliance repair page for Delhi NCR with its own name, a phone number and WhatsApp enquiry links. It does not claim to be an authorised service centre for any appliance brand, and the WhatsApp flag is only a contact channel. The form asks only for name and phone, with no password or payment fields.
The site presents itself as a kitchen appliance repair service with a contact form collecting name and phone number, but the evidence suggests a lead-generation or romance/tech-support scam operation: the domain name is generic and descriptive (.shop TLD), the form posts to itself with no legitimate business backend visible, all operator contact routes (9 links) funnel to WhatsApp (wa.me), and the scorer flagged 'WhatsApp' as a brand-in-title anomaly, indicating the WhatsApp operator contact is
A model looked at the screenshot and page text and wrote what it thought. It can be wrong, and it is not a finding.
What the page looked like on Friday, October 16, 2026
Same data as JSON: /api/zone/domain/kitchenchimneyrepairservice.shop. This page is not indexed by search engines and does not link to the site it describes.