Lowscore 16 · flagged Friday, September 25, 2026

qualitylawnsprinklerservicesllc.com

The census has no day-one record for this name inside its retained window. Full domain report

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

What matched

lure words (login, verify, secure…)
matched: service,services
+12
very long name
matched: 31
+4
Registrar
—
Nameserver provider
Nameservers
ns1.openprovider.nl, ns2.openprovider.be, ns3.openprovider.eu
First-day state
unknown
HTTP status
—
Page title
—
Has a form
no
Brand echoed
—

Same data as JSON: /api/zone/domain/qualitylawnsprinklerservicesllc.com. This page is not indexed by search engines and does not link to the site it describes.