Lowscore 12 · flagged Wednesday, September 16, 2026

seysemcleaningservicesprime.info

Appeared in the .info zone on Wednesday, September 16, 2026; by the end of that day the census found parked, for sale. Full domain report

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

What matched

lure words (login, verify, secure…)
matched: service,services
+12
Registrar
—
Nameserver provider
Nameservers
curitiba.ns.porkbun.com, fortaleza.ns.porkbun.com, maceio.ns.porkbun.com, salvador.ns.porkbun.com
First-day state
parked, for sale
HTTP status
200
Page title
seysemcleaningservicesprime.info — Coming Soon
Has a form
no
Brand echoed
—

Same data as JSON: /api/zone/domain/seysemcleaningservicesprime.info. This page is not indexed by search engines and does not link to the site it describes.