Lowscore 16 · flagged Saturday, September 19, 2026
silverlinechimneyfireplaceservices.site
Appeared in the .site zone on Saturday, September 19, 2026; by the end of that day the census found robots.txt denied. Full domain report
Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.
Own one of these names and think the listing is wrong? Tell us and a person will look.
What matched
lure words (login, verify, secure…)
matched: service,services
very long name
matched: 34
Registrar
—
Nameserver provider
Nameservers
hgns1.hostgator.com, hgns2.hostgator.com
First-day state
robots.txt denied
HTTP status
—
Page title
—
Has a form
no
Brand echoed
—
Same data as JSON: /api/zone/domain/silverlinechimneyfireplaceservices.site. This page is not indexed by search engines and does not link to the site it describes.