Lowscore 12 · flagged Thursday, September 10, 2026
walnutcreekchmneycleaningandsweepllc.xyz
Appeared in the .xyz zone on Thursday, September 10, 2026; by the end of that day the census found parked, for sale. Full domain report
Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.
Own one of these names and think the listing is wrong? Tell us and a person will look.
What matched
very long name
matched: 36
TLD with a high abuse rate
matched: xyz
Registrar
—
Nameserver provider
Nameservers
dns1.registrar-servers.com, dns2.registrar-servers.com
First-day state
parked, for sale
HTTP status
200
Page title
Walnut Creek Chimney Cleaning & Sweep LLC | Professional Chimney Services in Contra Costa County
Has a form
no
Brand echoed
—
Same data as JSON: /api/zone/domain/walnutcreekchmneycleaningandsweepllc.xyz. This page is not indexed by search engines and does not link to the site it describes.