Lowscore 10 · flagged Friday, September 4, 2026
zorvaniqsaltlakecityappliancerepairservice.site
Appeared in the .site zone on Friday, September 4, 2026; by the end of that day the census found active website about construction trades. Full domain report
Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.
Own one of these names and think the listing is wrong? Tell us and a person will look.
What matched
lure words (login, verify, secure…)
matched: service
very long name
matched: 42
Registrar
—
Nameserver provider
Nameservers
horizon.dns-parking.com, orbit.dns-parking.com
First-day state
active website
HTTP status
200
Page title
Zorvaniq Salt Lake City Appliance Repair Service
Has a form
no
Brand echoed
—
Same data as JSON: /api/zone/domain/zorvaniqsaltlakecityappliancerepairservice.site. This page is not indexed by search engines and does not link to the site it describes.