dns.pizza

Flagged newborn domains, Thursday, August 27, 2026

17,538 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

Critical+High+Medium+Low+day:10-3010-2910-2810-2710-2610-2510-2410-2310-2210-21
Lowsamtklang.beautyscore 16· robots.txt denied
TLD with a high abuse rate “beauty”free DNS provider “dnsowl.com”
Lowsantander.latscore 16echoes santander
brand in the name “santander”brand name behind Cloudflare “cloudflare.com”
Lowsatlock.xyzscore 16
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowsavero.icuscore 16· server error
TLD with a high abuse rate “icu”free DNS provider “dnsowl.com”
Lowsbzxf.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowsc-kde-website-cybersecurity-marketing.comscore 16
lure words (login, verify, secure…) “security”many hyphens “4”very long name “38”
Lowscalpstudio.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowscrapingdatanow.buzzscore 16
TLD with a high abuse rate “buzz”free DNS provider “dnsowl.com”
Lowscriptlist.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowsculpttnation.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowsdetyyhf.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowsdsa12.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowsdsss3223.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowse-dkfjk.buzzscore 16· no DNS
TLD with a high abuse rate “buzz”free DNS provider “dnsowl.com”
Lowse-dkfjk.cyouscore 16· no DNS
TLD with a high abuse rate “cyou”free DNS provider “dnsowl.com”
Lowse-dkfjk.homesscore 16· no DNS
TLD with a high abuse rate “homes”free DNS provider “dnsowl.com”
Lowse-dkfjk.lolscore 16· no DNS
TLD with a high abuse rate “lol”free DNS provider “dnsowl.com”
Lowse-kuo.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowse-sksjk.buzzscore 16· no DNS
TLD with a high abuse rate “buzz”free DNS provider “dnsowl.com”
Lowse-sksjk.cyouscore 16· no DNS
TLD with a high abuse rate “cyou”free DNS provider “dnsowl.com”
Lowse-sksjk.homesscore 16· no DNS
TLD with a high abuse rate “homes”free DNS provider “dnsowl.com”
Lowse-sksjk.lolscore 16· no DNS
TLD with a high abuse rate “lol”free DNS provider “dnsowl.com”
Lowse-szkjdf.buzzscore 16
TLD with a high abuse rate “buzz”free DNS provider “dnsowl.com”
Lowse-szkjdf.cfdscore 16
TLD with a high abuse rate “cfd”free DNS provider “dnsowl.com”
Lowse-szkjdf.cyouscore 16
TLD with a high abuse rate “cyou”free DNS provider “dnsowl.com”
Lowse-szkjdf.xyzscore 16
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowsealspoonbeacon.beautyscore 16· robots.txt denied
TLD with a high abuse rate “beauty”free DNS provider “dnsowl.com”
Lowseidenhall.beautyscore 16· active website
TLD with a high abuse rate “beauty”free DNS provider “dnsowl.com”
Lowselectintegrityfamilyservices.orgscore 16
lure words (login, verify, secure…) “service,services”very long name “29”
Lowselector352.funscore 16· blocked the probe
TLD with a high abuse rate “fun”free DNS provider “dnsowl.com”
Lowselector81.sbsscore 16· active website
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowselector91.sbsscore 16
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowsem-zhiznej-2008.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowsentinelridgeadvisoryservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “29”
Lowsentogungcoboconstructionandtenderservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “42”
Lowseranova.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowserbahoki.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowserenia.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowservachello.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowsese2.xyzscore 16
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowsevennine.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowshapeto.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowshestoe-chuvstvo-1999.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowshiyj5.cfdscore 16
TLD with a high abuse rate “cfd”free DNS provider “dnsowl.com”
Lowshiyj6.cfdscore 16
TLD with a high abuse rate “cfd”free DNS provider “dnsowl.com”
Lowshiyj7.cfdscore 16
TLD with a high abuse rate “cfd”free DNS provider “dnsowl.com”
Lowshksf.xyzscore 16· boilerplate page
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowshopeup.cfdscore 16· robots.txt denied
TLD with a high abuse rate “cfd”free DNS provider “dnsowl.com”
Lowsidpotts.workscore 16
TLD with a high abuse rate “work”free DNS provider “dnsowl.com”
Lowsijdns.topscore 16
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”

Same data as JSON: /api/zone/risk?day=2026-08-27&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.