Flagged newborn domains, Friday, August 28, 2026

9,218 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

Lowyeschkere.tattooscore 20· active website
brand in page title, not in the nametelegram
Lowymtjob365.onlinescore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowymtjob365.sitescore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowyofi-bella.storescore 20· other
brand in page title, not in the namecloudflare
Lowyogaelsalvador.fitscore 20· active website
brand in page title, not in the namenamecheap
Lowyomumi.moescore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowyourfindsblog.storescore 20· other
brand in page title, not in the namecloudflare
Lowyunshophun.vipscore 20· other
brand in page title, not in the namecloudflare
Lowyunxiai.orgscore 20· server error
brand in page title, not in the namecloudflare
Lowzafishadow.storescore 20· empty page
brand in page title, not in the namegoogle
Lowzahlung-sicher.onlinescore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzaidal-amrial-yamani.orgscore 20· parked, for sale
brand in page title, not in the namecloudflare
Lowzakupy-biedronkosale.shopscore 20· other
brand in page title, not in the namecloudflare
Lowzapanonimo.sitescore 20· redirects elsewhere
brand in page title, not in the namewhatsapp
Lowzapassist.shopscore 20· active website
brand in page title, not in the namewhatsapp
Lowzapfigurinhas.onlinescore 20· active website
brand in page title, not in the namewhatsapp
Lowzarvigo.spacescore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzarvigovirava.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzenbu.onescore 20· redirects elsewhere
brand in page title, not in the namewhatsapp
Lowzenithfight.worldscore 20· active website
brand in page title, not in the namerobinhood
Lowzenvyqo.storescore 20· other
brand in page title, not in the namecloudflare
Lowzerp.exchangescore 20· active website
brand in page title, not in the nameledger
Lowzjfurfeq.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowznexgadget.storescore 20· other
brand in page title, not in the namecloudflare
Lowzonda.websitescore 20· active website
brand in page title, not in the namewhatsapp
Lowzoomerfi.tradescore 20· active website
brand in page title, not in the namerobinhood
Lowzovmsc.latscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzyntax.digitalscore 20· active website
brand in page title, not in the namegoogle
Lowzyvellen.storescore 20· active website
brand in page title, not in the nameshopee
lure words (login, verify, secure…)security,service,services
Low4wardpaymentservices.infoscore 18· redirects elsewhere
lure words (login, verify, secure…)payment,payments,service,services
lure words (login, verify, secure…)tax,updatemany hyphens3
lure words (login, verify, secure…)access,portalmany hyphens3
lure words (login, verify, secure…)access,reward,rewards
Lowalwaysdiscreetwalmartsweepstake.comscore 18echoes walmart
brand in the namewalmartvery long name31
Lowantico-casale-il-sambuco-bandb.clickscore 18· active website
many hyphens4very long name30TLD with a high abuse rateclick
lure words (login, verify, secure…)security,service,services
Lowapplealertsupport.shopscore 18· no DNS
lure words (login, verify, secure…)alert,alerts,support
lure words (login, verify, secure…)claim,claims,service
lure words (login, verify, secure…)service,services,signin
Lowaustria-krypto-spielbank-spin.funscore 18· redirects elsewhere
many hyphens3very long name29TLD with a high abuse ratefun
lure words (login, verify, secure…)account,service,services
Lowbag88.topscore 18· active website
TLD with a high abuse ratetoppage sells replica goodsReplica Handbag
Lowbahsegel-mobil-girisleri-adresi.icuscore 18· placeholder page
many hyphens3very long name31TLD with a high abuse rateicu
Lowbahsegel-tr-resmi-giris-adresi.icuscore 18· placeholder page
many hyphens4very long name30TLD with a high abuse rateicu
many hyphens4very long name38TLD with a high abuse ratehair
lure words (login, verify, secure…)password,recover,recovery
Lowbirdsnesthalifax.livescore 18· active website
form on a brand-styled pagehas_form
lure words (login, verify, secure…)claim,service,services
Lowcalling-zoom.icuscore 18echoes zoom· robots.txt denied
ambiguous brand wordzoomTLD with a high abuse rateicubrand name behind Cloudflarecloudflare.com

Same data as JSON: /api/zone/risk?day=2026-08-28&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.