dns.pizza

Flagged newborn domains, Tuesday, September 1, 2026

12,278 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

Critical+High+Medium+Low+day:09-0409-0309-0209-0108-3108-3008-2908-2808-27
Lowaasa.autosscore 16· robots.txt denied
TLD with a high abuse rate “autos”free DNS provider “dnsowl.com”
Lowabixdunojoreno.xyzscore 16· robots.txt denied
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowabixxenoharivo.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowabixyavilavero.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowaccountholderverificationwebform.comscore 16
lure words (login, verify, secure…) “account,verification”very long name “32”
Lowaceforensicconsultingservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “29”
Lowadbncx.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowadmiralx-ewmp.topscore 16· blocked the probe
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowadmiralx-ils.topscore 16· blocked the probe
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowadmiralx-nlz.topscore 16· blocked the probe
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowadmiralx-pre.topscore 16· blocked the probe
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowadmiralx-qzx.topscore 16· blocked the probe
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowadmiralx-tak.topscore 16· blocked the probe
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowadmiralx-wja.topscore 16· blocked the probe
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowadult-ai.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowafcmxubk.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowaifangan.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowairoutermodel.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowairpons.funscore 16· boilerplate page
TLD with a high abuse rate “fun”free DNS provider “dnsowl.com”
Lowakdjfhdjdjvddmmmmxxx.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowakjdddkidvnkdkvgggg.xyzscore 16· no DNS
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowalgaecal.camscore 16· active website
TLD with a high abuse rate “cam”free DNS provider “dnsowl.com”
Lowalhambrachimneymasonryservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “30”
Lowalluringpropertyservicesgroup.comscore 16
lure words (login, verify, secure…) “service,services”very long name “29”
Lowalphacleaningservicesolution.comscore 16
lure words (login, verify, secure…) “service,services”very long name “28”
Lowalviondaveromavi.xyzscore 16· robots.txt denied
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowalvionjorenoabix.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowalvionjorenoxavi.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowalvionparenohivo.xyzscore 16· robots.txt denied
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowamericaexecutivecleanservices.infoscore 16· suspended
lure words (login, verify, secure…) “service,services”very long name “29”
Lowamericancollateralrecoverygroup.comscore 16
lure words (login, verify, secure…) “recover,recovery”very long name “31”
Lowaminamin.topscore 16· blocked the probe
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowanxindaojia.xyzscore 16· active website
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowapioc.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowapkcl.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowapkm.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowapqoq.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowapqtq.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowarkansasspecialtyservicesllc.comscore 16
lure words (login, verify, secure…) “service,services”very long name “28”
Lowasevpark.cfdscore 16· boilerplate page
TLD with a high abuse rate “cfd”free DNS provider “dnsowl.com”
Lowasevpark.sbsscore 16· boilerplate page
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowasevpark.skinscore 16· boilerplate page
TLD with a high abuse rate “skin”free DNS provider “dnsowl.com”
Lowaskld.lolscore 16· boilerplate page
TLD with a high abuse rate “lol”free DNS provider “dnsowl.com”
Lowasxmnx.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowasznxg.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowauthenticate-live-document-real-estate.comscore 16
lure words (login, verify, secure…) “authenticate”many hyphens “4”very long name “38”
Lowauthenticate-live-realestate-document.comscore 16
lure words (login, verify, secure…) “authenticate”many hyphens “3”very long name “37”
Lowavenros.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowavnslabcorewallcuttingservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “30”
Lowavuvb.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”

Same data as JSON: /api/zone/risk?day=2026-09-01&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.