Flagged newborn domains, Tuesday, September 8, 2026

11,571 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

many hyphens6very long name31
many hyphens6very long name31
many hyphens6very long name31
many hyphens6very long name31
many hyphens6very long name31
many hyphens6very long name31
many hyphens6very long name31
many hyphens6very long name31
many hyphens6very long name31
many hyphens6very long name31
many hyphens6very long name31
Lowequity-ledger-study.comscore 10echoes ledger
ambiguous brand wordledgerbrand name behind Cloudflarecloudflare.com
lure words (login, verify, secure…)servicevery long name28
many hyphens3very long name36
many hyphens4very long name29
Lowexxonmobil-ipa-isopropyl-alcohol-supplier.ltdscore 10· blocked the probe
many hyphens4very long name41
lure words (login, verify, secure…)limitedvery long name29
many hyphens3very long name32
many hyphens3very long name32
many hyphens4very long name35
Lowfine-watches.orgscore 10· active website
page sells replica goodsReplica Watch
Lowfireplacedraftchimneyservice.sitescore 10· active website
lure words (login, verify, secure…)servicevery long name28
Lowflorence-entrepreneurship-hub-llc.orgscore 10· active website
many hyphens3very long name33
Lowfrederick-wallpaper-creations-group.spacescore 10· active website
many hyphens3very long name35
many hyphens3very long name29
many hyphens4very long name28
Lowgheorghe-linked-domain-autorenew.eusscore 10· no web server
many hyphens3very long name32
many hyphens3very long name34
many hyphens4very long name30
many hyphens3very long name31
lure words (login, verify, secure…)supportvery long name28
Lowgreattwentyeightworldupdates.comscore 10· empty page
lure words (login, verify, secure…)updatevery long name28
lure words (login, verify, secure…)servicevery long name29
many hyphens3very long name32
Lowherenguvenilirdenemebonuscusugibitr.vipscore 10· boilerplate page
lure words (login, verify, secure…)bonusvery long name35
Lowheritage-linen-finish-design.websitescore 10· placeholder page
many hyphens3very long name28
Lowheritage-mosaic-works-collective.onlinescore 10· placeholder page
many hyphens3very long name32
Lowhilfe-apple.comscore 10echoes apple
ambiguous brand wordapplebrand name behind Cloudflarecloudflare.com
Lowhollowtipsdisposableofficial.comscore 10· registrar placeholder
lure words (login, verify, secure…)officialvery long name28
Lowice-geometry-thickness-trust.comscore 10· empty page
many hyphens3very long name28
Lowikariajuicelimited-time-offer.onlinescore 10· active website
lure words (login, verify, secure…)limitedvery long name29
many hyphens3very long name30
Lowinternetcomputerdesktopwallet.orgscore 10· not probed yet
lure words (login, verify, secure…)walletvery long name29
many hyphens3very long name29
lure words (login, verify, secure…)servicevery long name28
Lowkani-banispar-sharingtools-review.onlinescore 10· registrar placeholder
many hyphens3very long name33
Lowkraken------zerkalo.infoscore 10echoes kraken· blocked the probe
ambiguous brand wordkrakenmany hyphens6
Lowkraken----slon.infoscore 10echoes kraken· blocked the probe
ambiguous brand wordkrakenmany hyphens4
Lowkraken----vhod.infoscore 10echoes kraken· not probed yet
ambiguous brand wordkrakenmany hyphens4
Lowkraken--onion-ssilka.infoscore 10echoes kraken· blocked the probe
ambiguous brand wordkrakenmany hyphens3

Same data as JSON: /api/zone/risk?day=2026-09-08&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.