Flagged newborn domains, Thursday, September 10, 2026

10,814 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)service,services
Lowchicken-road-bonus--de.inkscore 12· active website
lure words (login, verify, secure…)bonusmany hyphens4
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)service,services
Lowcitronpayments.comscore 12· no DNS
lure words (login, verify, secure…)payment,payments
Lowclaim-stonkfun.appscore 12· not probed yet
lure words (login, verify, secure…)claim,claims
Lowclaimgrove.storescore 12· active website
lure words (login, verify, secure…)claimform submits over plain HTTPhttp://claimgrove.store/
Lowclaims-3jane.comscore 12· empty page
lure words (login, verify, secure…)claim,claims
Lowclaims-etc.comscore 12· boilerplate page
lure words (login, verify, secure…)claim,claims
Lowclaims.ltdscore 12· active website
lure words (login, verify, secure…)claim,claims
Lowclaimsafe.devscore 12· active website
lure words (login, verify, secure…)claim,claims
lure words (login, verify, secure…)claim,claims
Lowclaimsnappy.appscore 12· active website
lure words (login, verify, secure…)claim,claims
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)portal,verification
Lowcloeservices.comscore 12
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)access,portal
Lowcoastalbendrewards.appscore 12· registrar placeholder
lure words (login, verify, secure…)reward,rewards
Lowcoastaldryerventservices.sitescore 12· active website
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)alert,reset
Lowcoinbasrecovery.comscore 12· boilerplate page
lure words (login, verify, secure…)recover,recovery
Lowcoinquestrewards.onlinescore 12· active website
lure words (login, verify, secure…)reward,rewards
lure words (login, verify, secure…)refund,refunds
Lowcollectrefunds.infoscore 12· not probed yet
lure words (login, verify, secure…)refund,refunds
Lowcollectrefunds.onlinescore 12· not probed yet
lure words (login, verify, secure…)refund,refunds
Lowcollectrefunds.orgscore 12· not probed yet
lure words (login, verify, secure…)refund,refunds
Lowcollectrefunds.storescore 12· not probed yet
lure words (login, verify, secure…)refund,refunds
lure words (login, verify, secure…)service,services
very long name33TLD with a high abuse ratetop
lure words (login, verify, secure…)recover,recovery
lure words (login, verify, secure…)service,services
Lowconciergeservicesca.orgscore 12· registrar placeholder
lure words (login, verify, secure…)service,services
Lowconsectetur-asperiores-aliquid.topscore 12· not probed yet
very long name30TLD with a high abuse ratetop
Lowconsequuntur-sit-exercitationem48.topscore 12· robots.txt denied
very long name33TLD with a high abuse ratetop
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)service,services
very long name29TLD with a high abuse rateclick
lure words (login, verify, secure…)track,tracking
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)account,service
Lowcopperflamechimneyservices.sitescore 12· robots.txt denied
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)payment,payments
Lowcoremarkservices.comscore 12· no web server
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)service,services
lure words (login, verify, secure…)service,services

Same data as JSON: /api/zone/risk?day=2026-09-10&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.