dns.pizza

Flagged newborn domains, Wednesday, September 16, 2026

15,119 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

Critical+High+Medium+Low+day:09-2209-2109-2009-1909-1809-1709-1609-1509-1409-13
Lowgreenskyvaletparkingservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “28”
Lowgridmere.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgshdb.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgudone-vip.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgudonestock.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgudux.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowgvcbgffghnjiuonline.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowgwswlf3o.menscore 16· robots.txt denied
TLD with a high abuse rate “men”free DNS provider “dnsowl.com”
Lowhangmingdikongapp8.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhaocangshop.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhapp-plus.sbsscore 16· active website
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowhashbrokerz.xyzscore 16· active website
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowhcikl.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowheisejidi.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhellmanapp8.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhepme.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhiretalentbridge.clickscore 16· robots.txt denied
TLD with a high abuse rate “click”free DNS provider “dnsowl.com”
Lowhiringnow.clickscore 16· robots.txt denied
TLD with a high abuse rate “click”free DNS provider “dnsowl.com”
Lowhkkbapp5.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhkparrotapp11.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhotlekdgirlz.hairscore 16· boilerplate page
TLD with a high abuse rate “hair”free DNS provider “dnsowl.com”
Lowhotlekdgirlz.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhqyl.skinscore 16· no web server
TLD with a high abuse rate “skin”free DNS provider “dnsowl.com”
Lowhuanyudikongapp22.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhufaqia.xyzscore 16· boilerplate page
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowhutoufa.xyzscore 16· boilerplate page
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowicchips.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowicuzbjtfklljq5e6uw.icuscore 16· no web server
TLD with a high abuse rate “icu”free DNS provider “dnsowl.com”
Lowieaypark.sbsscore 16· redirects elsewhere
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowimmigrationservicesusciscitizenship.orgscore 16· robots.txt denied
lure words (login, verify, secure…) “service,services”very long name “35”
Lowimuli.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowingles21.lolscore 16· boilerplate page
TLD with a high abuse rate “lol”free DNS provider “dnsowl.com”
Lowinter-cambio.topscore 16· empty page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowipfrs.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowiroclad.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowirrzf.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowitscutebraidshairrestorationservicesllc.orgscore 16· robots.txt denied
lure words (login, verify, secure…) “service,services”very long name “39”
Lowjaftt.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowjarumika.cyouscore 16· active website
TLD with a high abuse rate “cyou”free DNS provider “dnsowl.com”
Lowjasperharbor59.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowjayce2312jal.sbsscore 16· no web server
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowjensenhuh.funscore 16· active website
TLD with a high abuse rate “fun”free DNS provider “dnsowl.com”
Lowjetflushingandpaintingservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “30”
Lowjflla.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowjiajitt004.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowjiajitt005.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowjiajitt006.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowjikoks10.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowjimenezcleaningservicesjcsllc.comscore 16
lure words (login, verify, secure…) “service,services”very long name “29”
Lowjiuwcc.xyzscore 16· no DNS
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”

Same data as JSON: /api/zone/risk?day=2026-09-16&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.