dns.pizza

Flagged newborn domains, Thursday, September 17, 2026

11,750 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

Critical+High+Medium+Low+day:09-2209-2109-2009-1909-1809-1709-1609-1509-1409-13
Lowtaarsmzq.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtariktoto.xyzscore 16· robots.txt denied
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowtechneuro.xyzscore 16· robots.txt denied
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowtekeishasmobilenotaryservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “29”
Lowteknrpxnb.buzzscore 16· no DNS
TLD with a high abuse rate “buzz”free DNS provider “dnsowl.com”
Lowtelefoen.xyzscore 16· active website
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowtelephoen.xyzscore 16· active website
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowteqeyoxso.sbsscore 16· no DNS
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowtestonepage.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtevinnig.clickscore 16· robots.txt denied
TLD with a high abuse rate “click”free DNS provider “dnsowl.com”
Lowtgnvk.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowthehierachy.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowthueg.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowthunder-coins-hold-and-win-slot.comscore 16· no DNS
lure words (login, verify, secure…) “win”many hyphens “5”very long name “31”
Lowthyyadhg.sbsscore 16· no DNS
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowtideandturfpoolandlawnservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “30”
Lowtie-tie.questscore 16· no web server
TLD with a high abuse rate “quest”free DNS provider “dnsowl.com”
Lowtiedbult.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtigre-hk.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtjpymqyu.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtklive.momscore 16· no DNS
TLD with a high abuse rate “mom”free DNS provider “dnsowl.com”
Lowtkyeaei.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtmfbnkpo.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtnsopsaqa.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtombakwin.xyzscore 16· robots.txt denied
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowtplnjxd.icuscore 16· no DNS
TLD with a high abuse rate “icu”free DNS provider “dnsowl.com”
Lowtpmmlp.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtqkbsvtql.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtracerindiavehicletrackingsystem.onlinescore 16· active website
lure words (login, verify, secure…) “track,tracking”very long name “32”
Lowtryodyn.clickscore 16· robots.txt denied
TLD with a high abuse rate “click”free DNS provider “dnsowl.com”
Lowtscajgp.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtslkxs.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtspwbjesm.icuscore 16· no DNS
TLD with a high abuse rate “icu”free DNS provider “dnsowl.com”
Lowttdje.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowturdu.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowturkdizi.momscore 16· robots.txt denied
TLD with a high abuse rate “mom”free DNS provider “dnsowl.com”
Lowturkifsaclub201.sbsscore 16· active website
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowturkifsaclub202.sbsscore 16· active website
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowturkifsaclub203.sbsscore 16· blocked the probe
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowturkifsaclub204.sbsscore 16· blocked the probe
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowturkifsaclub205.sbsscore 16· blocked the probe
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowturkifsaclub206.sbsscore 16· blocked the probe
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowturkifsaclub207.sbsscore 16· blocked the probe
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowturkifsaclub208.sbsscore 16· blocked the probe
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowturkifsaclub209.sbsscore 16· blocked the probe
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowturkifsaclub210.sbsscore 16· blocked the probe
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowturkserial.momscore 16· robots.txt denied
TLD with a high abuse rate “mom”free DNS provider “dnsowl.com”
Lowtutanime1.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowtvsfnmcj.icuscore 16· no DNS
TLD with a high abuse rate “icu”free DNS provider “dnsowl.com”
Lowtwgak.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”

Same data as JSON: /api/zone/risk?day=2026-09-17&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.