Flagged newborn domains, Thursday, September 17, 2026

11,750 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

lure words (login, verify, secure…) “service,services”
Lowwolterservicesinc.onlinescore 12· not probed yet
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
Lowwrenrecoverysc.comscore 12· active website
lure words (login, verify, secure…) “recover,recovery”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “customer,portal”
Lowxairservices.comscore 12
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “reward,rewards”
lure words (login, verify, secure…) “reward,rewards”
very long name “57”TLD with a high abuse rate “click”
Lowxwalletofficial.sitescore 12· active website
lure words (login, verify, secure…) “official,wallet”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
Lowyemeidunlukuapingtanbawuniang.sbsscore 12· not probed yet
very long name “29”TLD with a high abuse rate “sbs”
Lowyesilirmaksehirplanlamatasarim.xyzscore 12· registrar placeholder
very long name “30”TLD with a high abuse rate “xyz”
Lowyinwenkuashuaihaicexieqiaoen.bondscore 12· boilerplate page
very long name “28”TLD with a high abuse rate “bond”
Lowymembers.appscore 12· empty page
lure words (login, verify, secure…) “member,members”
Lowyouleadservices.onlinescore 12· no web server
lure words (login, verify, secure…) “service,services”
Lowzafs-accounts.onlinescore 12· robots.txt denied
lure words (login, verify, secure…) “account,accounts”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “recover,recovery”
Lowzenithassetrecoveryllc.netscore 12· boilerplate page
lure words (login, verify, secure…) “recover,recovery”
very long name “57”TLD with a high abuse rate “click”
lure words (login, verify, secure…) “service,services”
Lowzooorewards.comscore 12
lure words (login, verify, secure…) “reward,rewards”
Lowztorservices.comscore 12
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
Lowzurihealthcareservices.onlinescore 12· no web server
lure words (login, verify, secure…) “service,services”
Low2026-claimbenefit.infoscore 11· blocked the probe
lure words (login, verify, secure…) “claim”random-looking name “H=3.62”
many hyphens “3”random-looking name “H=3.75”
lure words (login, verify, secure…) “account”random-looking name “H=3.78”
many hyphens “3”random-looking name “H=3.77”
many hyphens “3”random-looking name “H=3.70”
many hyphens “3”very long name “28”
many hyphens “4”very long name “32”
many hyphens “4”very long name “30”
many hyphens “3”very long name “31”
lure words (login, verify, secure…) “verification”very long name “28”
many hyphens “6”very long name “46”
Lowagence-referencement-ia-france.comscore 10· registrar placeholder
many hyphens “3”very long name “30”
Lowanindavealipguvenilirdenemebonusu.vipscore 10· boilerplate page
lure words (login, verify, secure…) “bonus”very long name “33”
many hyphens “7”very long name “46”
Lowapple-ad.shopscore 10echoes apple· not probed yet
ambiguous brand word “apple”brand name behind Cloudflare “cloudflare.com”
Lowapple-es.comscore 10echoes apple
ambiguous brand word “apple”brand name behind Cloudflare “cloudflare.com”
Lowapple-wealth.comscore 10echoes apple
ambiguous brand word “apple”brand name behind Cloudflare “cloudflare.com”
many hyphens “3”very long name “30”
many hyphens “5”very long name “48”
many hyphens “4”very long name “31”

Same data as JSON: /api/zone/risk?day=2026-09-17&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.