dns.pizza

Flagged newborn domains, Friday, September 18, 2026

10,897 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

Critical+High+Medium+Low+day:09-2209-2109-2009-1909-1809-1709-1609-1509-1409-13
Lowliushenglong.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowlizong3.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowlpqnk.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowlranc.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowlrxvd.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowlsblk.sbsscore 16· no DNS
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowlsozd.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowlwgec.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowlzxyz.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowm7test-devspn-jidoushatouroku-portal.comscore 16
lure words (login, verify, secure…) “portal”many hyphens “3”very long name “36”
Lowmabar88pintu.buzzscore 16· no web server
TLD with a high abuse rate “buzz”free DNS provider “dnsowl.com”
Lowmabar88pintu.clickscore 16· no web server
TLD with a high abuse rate “click”free DNS provider “dnsowl.com”
Lowmabar88pintu.cyouscore 16· no web server
TLD with a high abuse rate “cyou”free DNS provider “dnsowl.com”
Lowmabar88pintu.homesscore 16· no web server
TLD with a high abuse rate “homes”free DNS provider “dnsowl.com”
Lowmabar88pintu.icuscore 16· no web server
TLD with a high abuse rate “icu”free DNS provider “dnsowl.com”
Lowmabar88pintu.lolscore 16· no web server
TLD with a high abuse rate “lol”free DNS provider “dnsowl.com”
Lowmabar88pintu.momscore 16· no web server
TLD with a high abuse rate “mom”free DNS provider “dnsowl.com”
Lowmabar88pintu.monsterscore 16· no web server
TLD with a high abuse rate “monster”free DNS provider “dnsowl.com”
Lowmabar88pintu.skinscore 16· no web server
TLD with a high abuse rate “skin”free DNS provider “dnsowl.com”
Lowmabar88pintu.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmabar88pintu.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowmachrisandfkcleaningservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “28”
Lowmaiko.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmailchgroup1.clickscore 16· no web server
TLD with a high abuse rate “click”free DNS provider “dnsowl.com”
Lowmailchgroup1.sbsscore 16· no web server
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowmailchgroup1.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmailgroup1.clickscore 16· robots.txt denied
TLD with a high abuse rate “click”free DNS provider “dnsowl.com”
Lowmailgroup1.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmamengchenlink.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmarketplace88.sbsscore 16· boilerplate page
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowmastercard-ar.cyouscore 16· boilerplate page
TLD with a high abuse rate “cyou”free DNS provider “dnsowl.com”
Lowmatchlesshospitalityservices.onlinescore 16· active website
lure words (login, verify, secure…) “service,services”very long name “28”
Lowmaxwin88juara.buzzscore 16· no web server
TLD with a high abuse rate “buzz”free DNS provider “dnsowl.com”
Lowmaxwin88juara.clickscore 16· robots.txt denied
TLD with a high abuse rate “click”free DNS provider “dnsowl.com”
Lowmaxwin88juara.cyouscore 16· no web server
TLD with a high abuse rate “cyou”free DNS provider “dnsowl.com”
Lowmaxwin88juara.homesscore 16· no web server
TLD with a high abuse rate “homes”free DNS provider “dnsowl.com”
Lowmaxwin88juara.icuscore 16· no web server
TLD with a high abuse rate “icu”free DNS provider “dnsowl.com”
Lowmaxwin88juara.lolscore 16· no web server
TLD with a high abuse rate “lol”free DNS provider “dnsowl.com”
Lowmaxwin88juara.momscore 16· no web server
TLD with a high abuse rate “mom”free DNS provider “dnsowl.com”
Lowmaxwin88juara.monsterscore 16· no web server
TLD with a high abuse rate “monster”free DNS provider “dnsowl.com”
Lowmaxwin88juara.skinscore 16· no web server
TLD with a high abuse rate “skin”free DNS provider “dnsowl.com”
Lowmaxwin88juara.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmaxwin88juara.xyzscore 16· robots.txt denied
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowmehulimaitramatchmakingservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “31”
Lowmelbet-xla.topscore 16· blocked the probe
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmevenisova.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmgmdg.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmikk.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmoomeoo.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowmoomooo.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”

Same data as JSON: /api/zone/risk?day=2026-09-18&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.