Flagged newborn domains, Friday, September 25, 2026

11,420 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

lure words (login, verify, secure…) “recover,recovery”
lure words (login, verify, secure…) “reward,rewards”
lure words (login, verify, secure…) “service,services”
very long name “57”TLD with a high abuse rate “click”
lure words (login, verify, secure…) “service,services”
Lowcoercivecontrolexpertwitness.xyzscore 12· not probed yet
very long name “28”TLD with a high abuse rate “xyz”
lure words (login, verify, secure…) “customer,customers”
Lowcolepikehomeservices.comscore 12· robots.txt denied
lure words (login, verify, secure…) “service,services”
Lowcolombianwebsitedirectorysystemyo.clickscore 12· not probed yet
very long name “33”TLD with a high abuse rate “click”
lure words (login, verify, secure…) “recover,recovery”
lure words (login, verify, secure…) “payment,payments”
Lowcompasschimneysweepservices.sitescore 12· active website
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “confirm,confirmation”
lure words (login, verify, secure…) “confirm,confirmation”
lure words (login, verify, secure…) “confirm,confirmation”
lure words (login, verify, secure…) “confirm,confirmation”
lure words (login, verify, secure…) “service,services”
Lowconstructiveservicesllc.netscore 12· registrar placeholder
lure words (login, verify, secure…) “service,services”
Lowconsultingservices.storescore 12· active website
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “member,members”
Lowcontramosservices.comscore 12· redirects elsewhere
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,track”
Lowcoop-services.orgscore 12· not probed yet
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
Lowcoredigitalservices.solutionsscore 12· no web server
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
Lowcountrywidedumpsterrentalsmyrna.homesscore 12· active website
very long name “31”TLD with a high abuse rate “homes”
very long name “57”TLD with a high abuse rate “click”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “recover,recovery”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “prize,prizes”
Lowcrown-cashandprizesclub.infoscore 12· registrar placeholder
lure words (login, verify, secure…) “prize,prizes”
Lowcrown-cashandprizesclub.storescore 12· registrar placeholder
lure words (login, verify, secure…) “prize,prizes”
lure words (login, verify, secure…) “recover,recovery”
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”
Lowcurve-claims.tradescore 12· active website
lure words (login, verify, secure…) “claim,claims”
lure words (login, verify, secure…) “customer,customers”
Lowcustomersrv.sitescore 12· no DNS
lure words (login, verify, secure…) “customer,customers”
very long name “57”TLD with a high abuse rate “click”
lure words (login, verify, secure…) “service,services”
Lowd3a00c0464f1e7372cb0f940e85f24fc.cfdscore 12· no web server
very long name “32”TLD with a high abuse rate “cfd”
Lowdabliogcorrespondentefinanceiraltda.cfdscore 12· active website
very long name “35”TLD with a high abuse rate “cfd”
Lowdakarhmedicalservices.orgscore 12· no DNS
lure words (login, verify, secure…) “service,services”
lure words (login, verify, secure…) “service,services”

Same data as JSON: /api/zone/risk?day=2026-09-25&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.