dns.pizza

Flagged newborn domains, Saturday, October 3, 2026

9,828 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

Critical+High+Medium+Low+day:10-0910-0810-0710-0610-0510-0410-0310-0210-0109-30
Lowgames-jetton9.clickscore 16· boilerplate page
TLD with a high abuse rate “click”free DNS provider “dnsowl.com”
Lowgames-jetton9.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames113s.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames195z.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames244r.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames264e.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames264v.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames378t.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames392p.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames479p.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames610m.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames723y.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames817n.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames837g.topscore 16· placeholder page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames940j.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgames983w.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgaox.workscore 16· active website
TLD with a high abuse rate “work”free DNS provider “dnsowl.com”
Lowgcx1003.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgetyoulovehere.topscore 16· empty page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgiajha.sbsscore 16· boilerplate page
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowglobal-propertiesandservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “28”
Lowgloverefinedfinds.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgnaidnfjwi.topscore 16· boilerplate page
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgoapp401.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgolkwg.sbsscore 16· boilerplate page
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowgood85.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgpic1003.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgqpsh.xyzscore 16· no web server
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowguiadasmicro.cfdscore 16· no web server
TLD with a high abuse rate “cfd”free DNS provider “dnsowl.com”
Lowguiadasmicro.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowgy111000.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhammerandspadehandymanservices.comscore 16
lure words (login, verify, secure…) “service,services”very long name “30”
Lowhandelsdowney.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhappy6868.xyzscore 16· robots.txt denied
TLD with a high abuse rate “xyz”free DNS provider “dnsowl.com”
Lowharrowvane.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhashsmith.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhcx1003.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhkda.topscore 16· no web server
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhoneymoney-p5g.funscore 16· active website
TLD with a high abuse rate “fun”free DNS provider “dnsowl.com”
Lowhongchangl8.topscore 16· no DNS
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhowcaniupdatemypaymentmethod.comscore 16
lure words (login, verify, secure…) “payment,update”very long name “28”
Lowhpic1003.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowhtqgqf.sbsscore 16· active website
TLD with a high abuse rate “sbs”free DNS provider “dnsowl.com”
Lowhullcraft.boatsscore 16· robots.txt denied
TLD with a high abuse rate “boats”free DNS provider “dnsowl.com”
Lowibots.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowicx1003.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowiikknews.topscore 16· robots.txt denied
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowimperial-services-healthcare.comscore 16
lure words (login, verify, secure…) “service,services”very long name “28”
Lowinagtv62925135.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”
Lowinagtv7593823.topscore 16· active website
TLD with a high abuse rate “top”free DNS provider “dnsowl.com”

Same data as JSON: /api/zone/risk?day=2026-10-03&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.