Flagged newborn domains, Thursday, August 27, 2026

17,538 names at tier low or above, highest score first.

Signals, not verdicts. A domain appears here because heuristics matched its name, its infrastructure or the page it served on its first day. Where a model has looked at it, that is shown as an opinion with a confidence, not as a finding. Nothing on this page says a site is malicious. Read the evidence and decide for yourself.

Own one of these names and think the listing is wrong? Tell us and a person will look.

Lowzicandiamonds.comscore 20· other
brand in page title, not in the nameetsy
Lowzilitv81.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzilqdrfu.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzjmsegbv.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzkntfhcw.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzlougidx.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzmpvhjey.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowznqwikfz.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzoommarketplace.appscore 20· active website
brand in page title, not in the namenamecheap
Lowzoopunk.wikiscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzorxjlag.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzpsykmbh.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzqtzlnci.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzruamodj.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzsvbnpek.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowztwcofql.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzuxdpgrm.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzuxwepali.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzxeredwidfgdf.livescore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowzylosync.appscore 20· server error
brand in page title, not in the namecloudflare
Lowzypkorebu.shopscore 20· blocked the probe
brand in page title, not in the namecloudflare
Lowkraken-marketplace.techscore 19echoes kraken· server error
ambiguous brand wordkrakenbrand name and brand-styled pagekraken
Lowotoy-booking.devscore 19echoes booking· parked with ads
ambiguous brand wordbookingbrand name and brand-styled pagebooking
many hyphens3very long name29TLD with a high abuse ratexyz
lure words (login, verify, secure…)tax,updatemany hyphens3
lure words (login, verify, secure…)billing,service,services
lure words (login, verify, secure…)access,service,services
lure words (login, verify, secure…)account,accounts,verify
Lowaccountsupport.websitescore 18· no web server
lure words (login, verify, secure…)account,accounts,support
lure words (login, verify, secure…)account,accounts,support
lure words (login, verify, secure…)delivery,service,services
Lowai4ss-human-llm-alignment-survey1.topscore 18· active website
many hyphens4very long name33TLD with a high abuse ratetop
lure words (login, verify, secure…)payment,payments,portal
many hyphens3very long name28TLD with a high abuse ratetop
many hyphens3very long name30TLD with a high abuse ratemonster
Lowalwaysdiscreetwalmartsweepstakes.comscore 18echoes walmart
brand in the namewalmartvery long name32
Lowamberwood-at-holland-insights.homesscore 18· empty page
many hyphens3very long name29TLD with a high abuse ratehomes
lure words (login, verify, secure…)recover,recovery,service,services
lure words (login, verify, secure…)servicevery long name28TLD with a high abuse ratexyz
Lowapple-eg.clickscore 18echoes apple· empty page
ambiguous brand wordappleTLD with a high abuse rateclickbrand name behind Cloudflarecloudflare.com
Lowapple-game.clickscore 18echoes apple· empty page
ambiguous brand wordappleTLD with a high abuse rateclickbrand name behind Cloudflarecloudflare.com
Lowareadobeneficiariounipessoal.proscore 18echoes adobe· active website
brand in the nameadobevery long name28
lure words (login, verify, secure…)customer,customers,service
Lowaustralian-pokies-real-money.workscore 18· registrar placeholder
many hyphens3very long name28TLD with a high abuse ratework
lure words (login, verify, secure…)auth,portal,service
lure words (login, verify, secure…)officialvery long name35TLD with a high abuse ratewin
Lowb5c3a9e1-8f20-4d91-a7e3-6b52.icuscore 18· robots.txt denied
many hyphens4very long name28TLD with a high abuse rateicu
lure words (login, verify, secure…)delivery,parcel,parcels
Lowbandb-palermo-sole-and-cultura.clickscore 18· active website
many hyphens4very long name30TLD with a high abuse rateclick
many hyphens4very long name31TLD with a high abuse ratecfd

Same data as JSON: /api/zone/risk?day=2026-08-27&tier=low. Screenshots and the model's reasoning are on each domain's evidence page.